PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G47190.1
Common NameATMYB2, MYB2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 273aa    MW: 31447.8 Da    PI: 5.1993
Description myb domain protein 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G47190.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.19.7e-192269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv+ v  +G  +W+ Iar  g++Rt+k+c++rw++yl
      AT2G47190.1 22 KGPWTEEEDAILVNFVSIHGDARWNHIARSSGLKRTGKSCRLRWLNYL 69
                     79********************************************97 PP

2Myb_DNA-binding46.86.9e-1575118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE+  +++++ ++G++ W++Ia++++ gRt++++k++w++
      AT2G47190.1  75 RGNITLEEQFMILKLHSLWGNR-WSKIAQYLP-GRTDNEIKNYWRT 118
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.951773IPR017930Myb domain
SuperFamilySSF466891.09E-3019116IPR009057Homeodomain-like
SMARTSM007175.1E-162171IPR001005SANT/Myb domain
PfamPF002491.6E-162269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-222376IPR009057Homeodomain-like
CDDcd001671.94E-122469No hitNo description
SMARTSM007171.1E-1374122IPR001005SANT/Myb domain
PROSITE profilePS5129418.09874124IPR017930Myb domain
PfamPF002491.8E-1375118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-2277123IPR009057Homeodomain-like
CDDcd001672.00E-1079118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0030154Biological Processcell differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0005516Molecular Functioncalmodulin binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009047anatomystem
PO:0025281anatomypollen
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MEDYERINSN SPTHEEDSDV RKGPWTEEED AILVNFVSIH GDARWNHIAR SSGLKRTGKS  60
CRLRWLNYLR PDVRRGNITL EEQFMILKLH SLWGNRWSKI AQYLPGRTDN EIKNYWRTRV  120
QKQAKHLRCD VNSNLFKETM RNVWMPRLVE RINAQSLPTT CEQVESMITD PSQPVNEPSP  180
VEPGFVQFSQ NHHQQFVPAT ELSATSSNSP AETFSDVRGG VVNGSGYDPS GQTGFGEFND  240
WGCVGGDNMW TDEESFWFLQ DQFCPDTTSY SYN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26191244108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.363960.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible260581_at0.0
Expression AtlasAT2G47190-
AtGenExpressAT2G47190-
ATTED-IIAT2G47190-
Functional Description ? help Back to Top
Source Description
TAIREncodes a MYB transcription factor that possesses an R2R3 MYB DNA binding domain and is known to regulate the expression of salt- and dehydration-responsive genes. Has been shown to bind calmodulin.
Function -- GeneRIF ? help Back to Top
  1. a specific CaM isoform mediates salt-induced Ca2+ signaling through the activation of an MYB transcriptional activator, thereby resulting in salt tolerance in plants.
    [PMID: 15569682]
  2. MYB2 is involved in iron translocation from roots to shoots.
    [PMID: 17031393]
  3. Results demonstrate that the DNA-binding domain of AtMYB2 is inhibited by S-nitrosylation of Cys53 as a consequence of nitric oxide action.
    [PMID: 17686455]
  4. An AtMYB2-regulated post apical dominance mechanism by which Arabidopsis (Arabidopsis thaliana) inhibits the outgrowth of axillary buds as part of the whole plant senescence program, is reported.
    [PMID: 21543729]
  5. The AtMYB2 transcription factor can therefore interact with the choline monooxygenase promoter directly and regulate its downstream gene expression.
    [PMID: 22714268]
  6. AtMYB2 regulates plant responses to phosphate starvation by regulating the expression of the miR399 gene.
    [PMID: 23154535]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G47190.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G77120(A), AT5G25610(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, ethylene, salicylic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G32640
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G47190
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2291400.0AK229140.1 Arabidopsis thaliana mRNA for MYB transcription factor, complete cds, clone: RAFL16-42-L19.
GenBankAY5195790.0AY519579.1 Arabidopsis thaliana MYB transcription factor (At2g47190) mRNA, complete cds.
GenBankBT0109490.0BT010949.1 Arabidopsis thaliana At2g47190 gene, complete cds.
GenBankBT0116560.0BT011656.1 Arabidopsis thaliana At2g47190 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_182241.10.0R2R3 MYB DNA binding domain transcription factor
SwissprotQ9LDE14e-68MY108_ARATH; Transcription factor MYB108
TrEMBLQ390280.0Q39028_ARATH; ATMYB2
STRINGAT2G47190.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Dennis ES, et al.
    Molecular strategies for improving waterlogging tolerance in plants.
    J. Exp. Bot., 2000. 51(342): p. 89-97
    [PMID:10938799]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  4. Xiong L,Schumaker KS,Zhu JK
    Cell signaling during cold, drought, and salt stress.
    Plant Cell, 2002. 14 Suppl: p. S165-83
    [PMID:12045276]
  5. Zheng ZL, et al.
    Plasma membrane-associated ROP10 small GTPase is a specific negative regulator of abscisic acid responses in Arabidopsis.
    Plant Cell, 2002. 14(11): p. 2787-97
    [PMID:12417701]
  6. Abe H, et al.
    Arabidopsis AtMYC2 (bHLH) and AtMYB2 (MYB) function as transcriptional activators in abscisic acid signaling.
    Plant Cell, 2003. 15(1): p. 63-78
    [PMID:12509522]
  7. Kamiya T,Kawabe A,Miyashita NT
    Nucleotide polymorphism at the Atmyb2 locus of the wild plant Arabidopsis thaliana.
    Genet. Res., 2002. 80(2): p. 89-98
    [PMID:12534212]
  8. Heim MA, et al.
    The basic helix-loop-helix transcription factor family in plants: a genome-wide study of protein structure and functional diversity.
    Mol. Biol. Evol., 2003. 20(5): p. 735-47
    [PMID:12679534]
  9. Bae MS,Cho EJ,Choi EY,Park OK
    Analysis of the Arabidopsis nuclear proteome and its response to cold stress.
    Plant J., 2003. 36(5): p. 652-63
    [PMID:14617066]
  10. Villalobos MA,Bartels D,Iturriaga G
    Stress tolerance and glucose insensitive phenotypes in Arabidopsis overexpressing the CpMYB10 transcription factor gene.
    Plant Physiol., 2004. 135(1): p. 309-24
    [PMID:15122027]
  11. Lorenzo O,Chico JM,S
    JASMONATE-INSENSITIVE1 encodes a MYC transcription factor essential to discriminate between different jasmonate-regulated defense responses in Arabidopsis.
    Plant Cell, 2004. 16(7): p. 1938-50
    [PMID:15208388]
  12. Wang S, et al.
    Control of plant trichome development by a cotton fiber MYB gene.
    Plant Cell, 2004. 16(9): p. 2323-34
    [PMID:15316114]
  13. Anderson JP, et al.
    Antagonistic interaction between abscisic acid and jasmonate-ethylene signaling pathways modulates defense gene expression and disease resistance in Arabidopsis.
    Plant Cell, 2004. 16(12): p. 3460-79
    [PMID:15548743]
  14. Sell S,Hehl R
    Functional dissection of a small anaerobically induced bZIP transcription factor from tomato.
    Eur. J. Biochem., 2004. 271(22): p. 4534-44
    [PMID:15560794]
  15. Yoo JH, et al.
    Direct interaction of a divergent CaM isoform and the transcription factor, MYB2, enhances salt tolerance in arabidopsis.
    J. Biol. Chem., 2005. 280(5): p. 3697-706
    [PMID:15569682]
  16. Mohanty B,Krishnan SP,Swarup S,Bajic VB
    Detection and preliminary analysis of motifs in promoters of anaerobically induced genes of different plant species.
    Ann. Bot., 2005. 96(4): p. 669-81
    [PMID:16027132]
  17. Xin Z,Zhao Y,Zheng ZL
    Transcriptome analysis reveals specific modulation of abscisic acid signaling by ROP10 small GTPase in Arabidopsis.
    Plant Physiol., 2005. 139(3): p. 1350-65
    [PMID:16258012]
  18. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  19. Chen YH,Wu XM,Ling HQ,Yang WC
    Transgenic expression of DwMYB2 impairs iron transport from root to shoot in Arabidopsis thaliana.
    Cell Res., 2006. 16(10): p. 830-40
    [PMID:17031393]
  20. Shinozaki K,Yamaguchi-Shinozaki K
    Gene networks involved in drought stress response and tolerance.
    J. Exp. Bot., 2007. 58(2): p. 221-7
    [PMID:17075077]
  21. Serpa V, et al.
    Inhibition of AtMYB2 DNA-binding by nitric oxide involves cysteine S-nitrosylation.
    Biochem. Biophys. Res. Commun., 2007. 361(4): p. 1048-53
    [PMID:17686455]
  22. Papdi C, et al.
    Functional identification of Arabidopsis stress regulatory genes using the controlled cDNA overexpression system.
    Plant Physiol., 2008. 147(2): p. 528-42
    [PMID:18441225]
  23. Shangguan XX,Xu B,Yu ZX,Wang LJ,Chen XY
    Promoter of a cotton fibre MYB gene functional in trichomes of Arabidopsis and glandular trichomes of tobacco.
    J. Exp. Bot., 2008. 59(13): p. 3533-42
    [PMID:18711121]
  24. Guo Y,Gan S
    AtMYB2 regulates whole plant senescence by inhibiting cytokinin-mediated branching at late stages of development in Arabidopsis.
    Plant Physiol., 2011. 156(3): p. 1612-9
    [PMID:21543729]
  25. Rushton DL, et al.
    WRKY transcription factors: key components in abscisic acid signalling.
    Plant Biotechnol. J., 2012. 10(1): p. 2-11
    [PMID:21696534]
  26. Yu L, et al.
    AtMYB2 transcription factor can interact with the CMO promoter and regulate its downstream gene expression.
    Biotechnol. Lett., 2012. 34(9): p. 1749-55
    [PMID:22714268]
  27. Baek D, et al.
    Regulation of miR399f transcription by AtMYB2 affects phosphate starvation responses in Arabidopsis.
    Plant Physiol., 2013. 161(1): p. 362-73
    [PMID:23154535]
  28. Baek D,Park HC,Kim MC,Yun DJ
    The role of Arabidopsis MYB2 in miR399f-mediated phosphate-starvation response.
    Plant Signal Behav, 2013. 8(3): p. e23488
    [PMID:23333957]
  29. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  30. Urao T,Yamaguchi-Shinozaki K,Urao S,Shinozaki K
    An Arabidopsis myb homolog is induced by dehydration stress and its gene product binds to the conserved MYB recognition sequence.
    Plant Cell, 1993. 5(11): p. 1529-39
    [PMID:8312738]
  31. Urao T,Noji M,Yamaguchi-Shinozaki K,Shinozaki K
    A transcriptional activation domain of ATMYB2, a drought-inducible Arabidopsis Myb-related protein.
    Plant J., 1996. 10(6): p. 1145-8
    [PMID:9011094]
  32. Abe H, et al.
    Role of arabidopsis MYC and MYB homologs in drought- and abscisic acid-regulated gene expression.
    Plant Cell, 1997. 9(10): p. 1859-68
    [PMID:9368419]
  33. Hoeren FU,Dolferus R,Wu Y,Peacock WJ,Dennis ES
    Evidence for a role for AtMYB2 in the induction of the Arabidopsis alcohol dehydrogenase gene (ADH1) by low oxygen.
    Genetics, 1998. 149(2): p. 479-90
    [PMID:9611167]